PDB entry 1tp3

View 1tp3 on RCSB PDB site
Description: PDZ3 domain of PSD-95 protein complexed with KKETPV peptide ligand
Class: protein binding
Keywords: PDZ domain, PROTEIN BINDING
Deposited on 2004-06-15, released 2005-09-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Presynaptic density protein 95
    Species: Rattus norvegicus [TaxId:10116]
    Gene: DLG4, DLGH4, PSD95
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31016 (5-105)
      • cloning artifact (4)
      • cloning artifact (106-118)
    Domains in SCOPe 2.08: d1tp3a1, d1tp3a2, d1tp3a3
  • Chain 'B':
    Compound: KKETPV peptide ligand
    Species: synthetic, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 1TP3 (0-5)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1tp3A (A:)
gspeflgeedipreprrivihrgstglgfnivggedgegifisfilaggpadlsgelrkg
dqilsvngvdlrnasheqaaialknagqtvtiiaqykpeeysrfeansrvdssgrivtd

    Sequence, based on observed residues (ATOM records): (download) 
    >1tp3A (A:)
flgeedipreprrivihrgstglgfnivggedgegifisfilaggpadlsgelrkgdqil
svngvdlrnasheqaaialknagqtvtiiaqykpeeysrfeansrvdssgrivtd

  • Chain 'B':
    No sequence available.