PDB entry 1tof

View 1tof on RCSB PDB site
Description: thioredoxin h (oxidized form), nmr, 23 structures
Deposited on 1996-05-30, released 1996-12-07
The last revision prior to the SCOP 1.71 freeze date was dated 1999-07-09, with a file datestamp of 1999-07-08.
Experiment type: NMR23
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d1tof__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tof_ (-)
    ggsvividskaawdaqlakgkeehkpivvdftatwcgpckmiaplfetlsndyagkvifl
    kvdvdavaavaeaagitamptfhvykdgvkaddlvgasqdklkalvakhaaa