PDB entry 1tof

View 1tof on RCSB PDB site
Description: thioredoxin h (oxidized form), nmr, 23 structures
Class: electron transport
Keywords: oxidoreductase, electron transport
Deposited on 1996-05-30, released 1996-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin H
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Gene: THIOREDOXIN H CDNA (X78822 EMB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tofa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tofA (A:)
    ggsvividskaawdaqlakgkeehkpivvdftatwcgpckmiaplfetlsndyagkvifl
    kvdvdavaavaeaagitamptfhvykdgvkaddlvgasqdklkalvakhaaa