PDB entry 1toc

View 1toc on RCSB PDB site
Description: structure of serine proteinase
Class: complex (hydrolase/inhibitor)
Keywords: vitamin k, zymogen, gamma-carboxyglutamic acid, acute phase, liver, hydrolase, serine protease kunitz-like inhibitor, kringle, signal, complex (hydrolase/inhibitor) complex
Deposited on 1996-07-20, released 1997-07-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.23
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thrombin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1toc.1
  • Chain 'B':
    Compound: thrombin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1toc.1
  • Chain 'C':
    Compound: thrombin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1toc.2
  • Chain 'D':
    Compound: thrombin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1toc.2
  • Chain 'E':
    Compound: thrombin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1toc.3
  • Chain 'F':
    Compound: thrombin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1toc.3
  • Chain 'G':
    Compound: thrombin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1toc.4
  • Chain 'H':
    Compound: thrombin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1toc.4
  • Chain 'R':
    Compound: ornithodorin
    Species: Ornithodoros moubata [TaxId:6938]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1tocr1, d1tocr2
  • Chain 'S':
    Compound: ornithodorin
    Species: Ornithodoros moubata [TaxId:6938]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1tocs1, d1tocs2
  • Chain 'T':
    Compound: ornithodorin
    Species: Ornithodoros moubata [TaxId:6938]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1toct1, d1toct2
  • Chain 'U':
    Compound: ornithodorin
    Species: Ornithodoros moubata [TaxId:6938]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1tocu1, d1tocu2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tocA (A:)
    tsedhfqpffnektfgageadcglrplfekkqvqdqtekelfesyiegr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tocA (A:)
    adcglrplfekkqvqdqtekelfesyie
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tocB (B:)
    ivegqdaevglspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftvddll
    vrigkhsrtryerkvekismldkiyihprynwkenldrdiallklkrpielsdyihpvcl
    pdkqtaakllhagfkgrvtgwgnrretwttsvaevqpsvlqvvnlplverpvckastrir
    itdnmfcagykpgegkrgdacegdsggpfvmkspynnrwyqmgivswgegcdrdgkygfy
    thvfrlkkwiqkvidrlgs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1tocC (C:)
    tsedhfqpffnektfgageadcglrplfekkqvqdqtekelfesyiegr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tocC (C:)
    adcglrplfekkqvqdqtekelfesyie
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tocD (D:)
    ivegqdaevglspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftvddll
    vrigkhsrtryerkvekismldkiyihprynwkenldrdiallklkrpielsdyihpvcl
    pdkqtaakllhagfkgrvtgwgnrretwttsvaevqpsvlqvvnlplverpvckastrir
    itdnmfcagykpgegkrgdacegdsggpfvmkspynnrwyqmgivswgegcdrdgkygfy
    thvfrlkkwiqkvidrlgs
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1tocE (E:)
    tsedhfqpffnektfgageadcglrplfekkqvqdqtekelfesyiegr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tocE (E:)
    adcglrplfekkqvqdqtekelfesyie
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tocF (F:)
    ivegqdaevglspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftvddll
    vrigkhsrtryerkvekismldkiyihprynwkenldrdiallklkrpielsdyihpvcl
    pdkqtaakllhagfkgrvtgwgnrretwttsvaevqpsvlqvvnlplverpvckastrir
    itdnmfcagykpgegkrgdacegdsggpfvmkspynnrwyqmgivswgegcdrdgkygfy
    thvfrlkkwiqkvidrlgs
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1tocG (G:)
    tsedhfqpffnektfgageadcglrplfekkqvqdqtekelfesyiegr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tocG (G:)
    adcglrplfekkqvqdqtekelfesyie
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tocH (H:)
    ivegqdaevglspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftvddll
    vrigkhsrtryerkvekismldkiyihprynwkenldrdiallklkrpielsdyihpvcl
    pdkqtaakllhagfkgrvtgwgnrretwttsvaevqpsvlqvvnlplverpvckastrir
    itdnmfcagykpgegkrgdacegdsggpfvmkspynnrwyqmgivswgegcdrdgkygfy
    thvfrlkkwiqkvidrlgs
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tocR (R:)
    slnvlcnnphtadcnndaqvdryfregttclmspactsegyasqhecqqacfvggedhss
    emhssclgdpptscaegtdityydsdsktckvlaascpsgentfesevecqvacgapieg
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tocS (S:)
    slnvlcnnphtadcnndaqvdryfregttclmspactsegyasqhecqqacfvggedhss
    emhssclgdpptscaegtdityydsdsktckvlaascpsgentfesevecqvacgapieg
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tocT (T:)
    slnvlcnnphtadcnndaqvdryfregttclmspactsegyasqhecqqacfvggedhss
    emhssclgdpptscaegtdityydsdsktckvlaascpsgentfesevecqvacgapieg
    

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tocU (U:)
    slnvlcnnphtadcnndaqvdryfregttclmspactsegyasqhecqqacfvggedhss
    emhssclgdpptscaegtdityydsdsktckvlaascpsgentfesevecqvacgapieg