PDB entry 1tnq

View 1tnq on RCSB PDB site
Description: structures of the apo and calcium troponin-c regulatory domains: the muscle contraction switch
Class: calcium-binding protein
Keywords: ef-hand, calcium-binding protein
Deposited on 1995-07-07, released 1995-10-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: troponin-c
    Species: Gallus gallus [TaxId:9031]
    Gene: NTNC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1tnqa_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1tnqA (A:)
asmtdqqaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeelda
iieevdedgsgtidfeeflvmmvrqmkeda