PDB entry 1tnn

View 1tnn on RCSB PDB site
Description: tertiary structure of an immunoglobulin-like domain from the giant muscle protein titin: a new member of the i set
Deposited on 1995-01-17, released 1995-04-20
The last revision prior to the SCOP 1.57 freeze date was dated 1995-04-20, with a file datestamp of 1995-04-27.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1tnn__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tnn_ (-)
    riltkprsmtvyegesarfscdtdgepvptvtwlrkgqvlstsarhqvtttkykstfeis
    svqasdegnysvvvensegkqeaeftltiqk