PDB entry 1tm2

View 1tm2 on RCSB PDB site
Description: Crystal Structure of the apo form of the Salmonella typhimurium AI-2 receptor LsrB
Class: signaling protein
Keywords: periplasmic binding protein
Deposited on 2004-06-10, released 2004-09-28
The last revision prior to the SCOP 1.75 freeze date was dated 2004-09-28, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.191
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sugar transport protein
    Species: Salmonella typhimurium LT2
    Gene: LsrB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1tm2a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tm2A (A:)
    gsaeriafipklvgvgfftsggngaqeagkalgidvtydgptepsvsgqvqlvnnfvnqg
    ydaiivsavspdglcpalkramqrgvkiltwdsdtkpecrsyyinqgtpkqlgsmlvema
    ahqvdkekakvaffyssptvtdqnqwvkeakakisqehpgweivttqfgyndatkslqta
    egiikaypdldaiiapdanalpaaaqaaenlkrnnlaivgfstpnvmrpyvqrgtvkefg
    lwdvvqqgkisvyvanallknmpmnvgdsldipgigkvtvspnseqgyhyeakgngivll
    pervifnkdnidkydf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tm2A (A:)
    aeriafipklvgvgfftsggngaqeagkalgidvtydgptepsvsgqvqlvnnfvnqgyd
    aiivsavspdglcpalkramqrgvkiltwdsdtkpecrsyyinqgtpkqlgsmlvemaah
    qvdkekakvaffyssptvtdqnqwvkeakakisqehpgweivttqfgyndatkslqtaeg
    iikaypdldaiiapdanalpaaaqaaenlkrnnlaivgfstpnvmrpyvqrgtvkefglw
    dvvqqgkisvyvanallknmpmnvgdsldipgigkvtvspnseqgyhyeakgngivllpe
    rvifnkdnidkydf