PDB entry 1tko

View 1tko on RCSB PDB site
Description: Iron-oxo clusters biomineralizing on protein surfaces. Structural analysis of H.salinarum DpsA in its low and high iron states
Class: metal binding protein
Keywords: DpsA, high iron, iron cluster, METAL BINDING PROTEIN
Deposited on 2004-06-09, released 2004-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Iron-rich dpsA-homolog protein
    Species: Halobacterium salinarum [TaxId:2242]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tkoa_
  • Chain 'B':
    Compound: Iron-rich dpsA-homolog protein
    Species: Halobacterium salinarum [TaxId:2242]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tkob_
  • Chain 'C':
    Compound: Iron-rich dpsA-homolog protein
    Species: Halobacterium salinarum [TaxId:2242]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tkoc_
  • Chain 'D':
    Compound: Iron-rich dpsA-homolog protein
    Species: Halobacterium salinarum [TaxId:2242]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tkod_
  • Heterogens: SO4, FE, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tkoA (A:)
    mstqknaratagevegsdalrmdadraeqcvdalnadlanvyvlyhqlkkhhwnvegaef
    rdlhlflgeaaetaeevadelaervqalggvphaspetlqaeasvdvededvydirtsla
    ndmaiygdiieatrehtelaenlgdhatahmlreglieleddahhiehyleddtlvtqga
    le
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tkoA (A:)
    stqknaratagevegsdalrmdadraeqcvdalnadlanvyvlyhqlkkhhwnvegaefr
    dlhlflgeaaetaeevadelaervqalggvphaspetlqaeasvdvededvydirtslan
    dmaiygdiieatrehtelaenlgdhatahmlreglieleddahhiehyleddtlvtqgal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tkoB (B:)
    mstqknaratagevegsdalrmdadraeqcvdalnadlanvyvlyhqlkkhhwnvegaef
    rdlhlflgeaaetaeevadelaervqalggvphaspetlqaeasvdvededvydirtsla
    ndmaiygdiieatrehtelaenlgdhatahmlreglieleddahhiehyleddtlvtqga
    le
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tkoB (B:)
    aratagevegsdalrmdadraeqcvdalnadlanvyvlyhqlkkhhwnvegaefrdlhlf
    lgeaaetaeevadelaervqalggvphaspetlqaeasvdvededvydirtslandmaiy
    gdiieatrehtelaenlgdhatahmlreglieleddahhiehyleddtlvtqgal
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1tkoC (C:)
    mstqknaratagevegsdalrmdadraeqcvdalnadlanvyvlyhqlkkhhwnvegaef
    rdlhlflgeaaetaeevadelaervqalggvphaspetlqaeasvdvededvydirtsla
    ndmaiygdiieatrehtelaenlgdhatahmlreglieleddahhiehyleddtlvtqga
    le
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tkoC (C:)
    aratagevegsdalrmdadraeqcvdalnadlanvyvlyhqlkkhhwnvegaefrdlhlf
    lgeaaetaeevadelaervqalggvphaspetlqaeasvdvededvydirtslandmaiy
    gdiieatrehtelaenlgdhatahmlreglieleddahhiehyleddtlvtqgal
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1tkoD (D:)
    mstqknaratagevegsdalrmdadraeqcvdalnadlanvyvlyhqlkkhhwnvegaef
    rdlhlflgeaaetaeevadelaervqalggvphaspetlqaeasvdvededvydirtsla
    ndmaiygdiieatrehtelaenlgdhatahmlreglieleddahhiehyleddtlvtqga
    le
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tkoD (D:)
    aratagevegsdalrmdadraeqcvdalnadlanvyvlyhqlkkhhwnvegaefrdlhlf
    lgeaaetaeevadelaervqalggvphaspetlqaeasvdvededvydirtslandmaiy
    gdiieatrehtelaenlgdhatahmlreglieleddahhiehyleddtlvtqgal