PDB entry 1tk5

View 1tk5 on RCSB PDB site
Description: T7 DNA polymerase binary complex with 8 oxo guanosine in the templating strand
Class: transferase/electron transport/DNA
Keywords: 8-oxoguanosine DNA polymerase, TRANSFERASE/ELECTRON TRANSPORT/DNA COMPLEX
Deposited on 2004-06-08, released 2004-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.214
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase
    Species: Enterobacteria phage T7 [TaxId:10760]
    Gene: 5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tk5a1, d1tk5a2
  • Chain 'B':
    Compound: Thioredoxin 1
    Species: Escherichia coli [TaxId:562]
    Gene: TRXA, TSNC, FIPA, B3781, C4701, Z5291, ECS4714, STM3915, STMD1.75, STY3639, T3381, SF3854, S3905
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tk5b_
  • Chain 'P':
    Compound: 5'-d(*cp*gp*ap*ap*a*gp*cp*cp*ap*gp*tp*gp*cp*cp*ap*(ddg)p*tp*gp*cp*ap*a)-3'
  • Chain 'T':
    Compound: 5'-d(*cp*cp*cp*(8og)p*cp*tp*gp*gp*cp*ap*cp*tp*gp*gp*cp*cp*gp*tp*cp*gp*tp*tp*tp*tp*cp*g)-3'
  • Heterogens: MG, SO4, MES, 1PE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tk5A (A:)
    mivsdieanallesvtkfhcgviydystaeyvsyrpsdfgayldaleaevargglivfhn
    ghkydvpaltklaklqlnrefhlprencidtlvlsrlihsnlkdtdmgllrsgklpgale
    awgyrlgemkgeykddfkrmleeqgeeyvdgmewwnfneemmdynvqdvvvtkallekll
    sdkhyfppeidftdvgyttfwsesleavdiehraawllakqerngfpfdtkaieelyvel
    aarrsellrkltetfgswyqpkggtemfchprtgkplpkypriktpkvggifkkpknkaq
    regrepceldtreyvagapytpvehvvfnpssrdhiqkklqeagwvptkytdkgapvvdd
    evlegvrvddpekqaaidlikeylmiqkrigqsaegdkawlryvaedgkihgsvnpngav
    tgrathafpnlaqipgvrspygeqcraafgaehhldgitgkpwvqagidasglelrclah
    fmarfdngeyaheilngdihtknqiaaelptrdnaktfiygflygagdekigqivgagke
    rgkelkkkflentpaiaalresiqqtlvessqwvageqqvkwkrrwikgldgrkvhvrsp
    haalntllqsagalicklwiikteemlvekglkhgwdgdfaymawvhdeiqvgcrteeia
    qvvietaqeamrwvgdhwnfrclldtegkmgpnwaich
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tk5A (A:)
    mivsdieanallesvtkfhcgviydystaeyvsyrpsdfgayldaleaevargglivfhn
    ghkydvpaltklaklqlnrefhlprencidtlvlsrlihsnlkdtdmgllrsgklpgale
    awgyrlgemkgeykddfkrmleeqgeeyvdgmewwnfneemmdynvqdvvvtkallekll
    sdkhyfppeidftdvgyttfwsesleavdiehraawllakqerngfpfdtkaieelyvel
    aarrsellrkltetfgswyqpkggtemfchprtgkplpkypriktpkvggifkkpkaqre
    grceldtreyvagapytpvehvvfnpssrdhiqkklqeagwvptkytdkgapvvddevle
    gvrvddpekqaaidlikeylmiqkrigqsaegdkawlryvaedgkihgsvnpngavtgra
    thafpnlaqipgvrspygeqcraafgaehhldgitgkpwvqagidasglelrclahfmar
    fdngeyaheilngdihtknqiaaelptrdnaktfiygflygaigqivgagkergkelkkk
    flentpaiaalresiqqtlvesvkwkrrwikgldgrkvhvrsphaalntllqsagalick
    lwiikteemlvekglkhgwdgdfaymawvhdeiqvgcrteeiaqvvietaqeamrwvgdh
    wnfrclldtegkmgpnwaich
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tk5B (B:)
    sdkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklni
    dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tk5B (B:)
    kiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnidq
    npgtapkygirgiptlllfkngevaatkvgalskgqlkefldanl
    

  • Chain 'P':
    No sequence available.

  • Chain 'T':
    No sequence available.