PDB entry 1tjy

View 1tjy on RCSB PDB site
Description: Crystal Structure of Salmonella typhimurium AI-2 receptor LsrB in complex with R-THMF
Class: signaling protein
Keywords: protein-ligand complex, signaling protein
Deposited on 2004-06-07, released 2004-09-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.156
AEROSPACI score: 0.79 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sugar transport protein
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: LsrB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8Z2X8 (2-315)
      • cloning artifact (0-1)
    Domains in SCOPe 2.07: d1tjya1, d1tjya2
  • Heterogens: PAV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tjyA (A:)
    gsaeriafipklvgvgfftsggngaqeagkalgidvtydgptepsvsgqvqlvnnfvnqg
    ydaiivsavspdglcpalkramqrgvkiltwdsdtkpecrsyyinqgtpkqlgsmlvema
    ahqvdkekakvaffyssptvtdqnqwvkeakakisqehpgweivttqfgyndatkslqta
    egiikaypdldaiiapdanalpaaaqaaenlkrnnlaivgfstpnvmrpyvqrgtvkefg
    lwdvvqqgkisvyvanallknmpmnvgdsldipgigkvtvspnseqgyhyeakgngivll
    pervifnkdnidkydf