PDB entry 1tjt

View 1tjt on RCSB PDB site
Description: X-ray structure of the human alpha-actinin isoform 3 at 2.2A resolution
Class: contractile protein
Keywords: Calponin homology domain, actin binding domain, CONTRACTILE PROTEIN
Deposited on 2004-06-07, released 2005-05-17
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: 0.227
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-actinin 3
    Species: Homo sapiens [TaxId:9606]
    Gene: ACTN3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1tjta1, d1tjta2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tjtA (A:)
    ssymeqeedwdrdllldpawekqqrktftawcnshlrkagtqienieedfrnglklmlll
    evisgerlprpdkgkmrfhkianvnkaldfiaskgvklvsigaeeivdgnlkmtlgmiwt
    iilrfaiqdisveetsakeglllwcqrktapyrnvnvqnfhtswkdglalcalihrhrpd
    lidyaklrkddpignlntafevaekyldipkmldaedivntpkpdekaimtyvscfyhaf
    agaeqaetaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tjtA (A:)
    awekqqrktftawcnshlrkagtqienieedfrnglklmlllevisgerlprpdkgkmrf
    hkianvnkaldfiaskgvklvsigaeeivdgnlkmtlgmiwtiilrfaiqdisveetsak
    eglllwcqrktapyrnvnvqnfhtswkdglalcalihrhrpdlidyaklrkddpignlnt
    afevaekyldipkmldaedivntpkpdekaimtyvscfyhafag