PDB entry 1tjp

View 1tjp on RCSB PDB site
Description: Crystal Structure Of Wild-Type Tryptophan Synthase Complexed With 1-[(2-hydroxylphenyl)amino]3-glycerolphosphate
Class: lyase
Keywords: substrate channeling, transition state analog, enzymatic mechanism, allosteric regulation, LYASE
Deposited on 2004-06-07, released 2005-12-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.167
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tryptophan synthase alpha chain
    Species: Salmonella typhimurium [TaxId:602]
    Gene: TRPA, STM1727
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tjpa_
  • Chain 'B':
    Compound: tryptophan synthase beta chain
    Species: Salmonella typhimurium [TaxId:602]
    Gene: TRPB, STM1726, STY1325, T1638
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tjpb_
  • Heterogens: NA, HPF, PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tjpA (A:)
    meryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdplad
    gptiqnanlrafaagvtpaqcfemlalirekhptipigllmyanlvfnngidafyarceq
    vgvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllsrs
    gvtgaenrgalplhhlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivki
    ieknlaspkqmlaelrsfvsamkaasra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tjpA (A:)
    meryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdplad
    gptiqnanlrafaagvtpaqcfemlalirekhptipigllmyanlvfnngidafyarceq
    vgvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllsrs
    gvtgaenrgalplhhlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivki
    ieknlaspkqmlaelrsfvsamkaasr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tjpB (B:)
    ttllnpyfgefggmyvpqilmpalnqleeafvsaqkdpefqaqfadllknyagrptaltk
    cqnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasal
    asallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsy
    etahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmf
    adfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysis
    agldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkm
    mreqpekeqllvvnlsgrgdkdiftvhdilkargei
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tjpB (B:)
    ttllnpyfgefggmyvpqilmpalnqleeafvsaqkdpefqaqfadllknyagrptaltk
    cqnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasal
    asallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsy
    etahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmf
    adfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysis
    agldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkm
    mreqpekeqllvvnlsgrgdkdiftvhdilkarg