PDB entry 1tix

View 1tix on RCSB PDB site
Description: thermostable xylanase i from thermoascus aurantiacus
Deposited on 1998-10-13, released 1999-08-02
The last revision prior to the SCOP 1.59 freeze date was dated 1999-12-22, with a file datestamp of 1999-12-21.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.164
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1tixa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tixA (A:)
    asaqsvdqlikargkvyfgvatdqnrlttgknaaiiqadfgqvtpensmkwdatepsqgn
    fnfagadylvnwaqqngklirghtlvwhsqlpswvtsitdkntltnvmknhittlmtryk
    gkirawdvvneafnqngslrstvflnvigedyipiafqtaraadpnaklyindynldsat
    ypktqaivnrvkqwraagvpidgigsqthlsagqgagvlnalpllasagtpevaiteldv
    agasptdyvnvvnaclnvsscvgitvwgvadpdswrasttpllfdgnfnpkpaynaivqn
    lq