PDB entry 1tiu

View 1tiu on RCSB PDB site
Description: titin, ig repeat 27, nmr, 24 structures
Deposited on 1996-02-02, released 1996-07-11
The last revision prior to the SCOP 1.55 freeze date was dated 1996-07-11, with a file datestamp of 1996-07-11.
Experiment type: NMR24
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1tiu__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1tiu_ (-)
  lievekplygvevfvgetahfeielsepdvhgqwklkgqpltaspdceiiedgkkhilil
  hncqlgmtgevsfqaanaksaanlkvkel