PDB entry 1tit

View 1tit on RCSB PDB site
Description: titin, ig repeat 27, nmr, minimized average structure
Deposited on 1996-02-02, released 1996-07-11
The last revision prior to the SCOP 1.57 freeze date was dated 1996-07-11, with a file datestamp of 1996-07-11.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1tit__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tit_ (-)
    lievekplygvevfvgetahfeielsepdvhgqwklkgqpltaspdceiiedgkkhilil
    hncqlgmtgevsfqaanaksaanlkvkel