PDB entry 1ti3

View 1ti3 on RCSB PDB site
Description: Solution structure of the Thioredoxin h1 from poplar, a CPPC active site variant
Class: oxidoreductase
Keywords: oxidoreductase, thioredoxin, NMR
Deposited on 2004-06-02, released 2004-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin H
    Species: Populus tremula [TaxId:113636]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ti3a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ti3A (A:)
    aeegqviachtvdtwkehfekgkgsqklivvdftaswcppckmiapifaelakkfpnvtf
    lkvdvdelkavaeewnveamptfiflkdgklvdktvgadkdglptlvakhata