PDB entry 1thx

View 1thx on RCSB PDB site
Description: thioredoxin-2
Class: electron transport
Keywords: oxido-reductase
Deposited on 1995-07-07, released 1995-10-15
The last revision prior to the SCOP 1.73 freeze date was dated 1995-10-15, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.175
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin
    Species: ANABAENA SP.
    Gene: trxA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1thxa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1thxA (A:)
metamskgvititdaefesevlkaeqpvlvyfwaswcgpcqlmsplinlaantysdrlkv
vkleidpnpttvkkykvegvpalrlvkgeqildstegviskdkllsfldthlnnn

    Sequence, based on observed residues (ATOM records): (download) 
    >1thxA (A:)
skgvititdaefesevlkaeqpvlvyfwaswcgpcqlmsplinlaantysdrlkvvklei
dpnpttvkkykvegvpalrlvkgeqildstegviskdkllsfldthln