PDB entry 1thx

View 1thx on RCSB PDB site
Description: thioredoxin-2
Deposited on 1995-07-07, released 1995-10-15
The last revision prior to the SCOP 1.71 freeze date was dated 1995-10-15, with a file datestamp of 1995-10-16.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.175
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d1thx__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download) 
    >1thx_ (-)
metamskgvititdaefesevlkaeqpvlvyfwaswcgpcqlmsplinlaantysdrlkv
vkleidpnpttvkkykvegvpalrlvkgeqildstegviskdkllsfldthlnnn

    Sequence, based on observed residues (ATOM records): (download) 
    >1thx_ (-)
skgvititdaefesevlkaeqpvlvyfwaswcgpcqlmsplinlaantysdrlkvvklei
dpnpttvkkykvegvpalrlvkgeqildstegviskdkllsfldthln