PDB entry 1thx

View 1thx on RCSB PDB site
Description: thioredoxin-2
Class: electron transport
Keywords: oxido-reductase, electron transport
Deposited on 1995-07-07, released 1995-10-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.175
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin
    Species: Nostoc sp. [TaxId:103690]
    Gene: trxA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1thxa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1thxA (A:)
    metamskgvititdaefesevlkaeqpvlvyfwaswcgpcqlmsplinlaantysdrlkv
    vkleidpnpttvkkykvegvpalrlvkgeqildstegviskdkllsfldthlnnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1thxA (A:)
    skgvititdaefesevlkaeqpvlvyfwaswcgpcqlmsplinlaantysdrlkvvklei
    dpnpttvkkykvegvpalrlvkgeqildstegviskdkllsfldthln