PDB entry 1tho

View 1tho on RCSB PDB site
Description: crystal structure of a mutant escherichia coli thioredoxin with an arginine insertion in the active site
Class: electron transport
Keywords: electron transport
Deposited on 1993-01-28, released 1993-10-31
The last revision prior to the SCOP 1.73 freeze date was dated 1993-10-31, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 2.3 Å
R-factor: 0.173
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: thioredoxin
  Species: ESCHERICHIA COLI
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0AA25 (0-108)
    • insertion (32)
  Domains in SCOP 1.73: d1thoa_
• Heterogens: CU, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1thoA (A:)
  sdkiihltddsfdtdvlkadgailvdfwaewcgrpckmiapildeiadeyqgkltvakln
  idqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla