PDB entry 1tho

View 1tho on RCSB PDB site
Description: crystal structure of a mutant escherichia coli thioredoxin with an arginine insertion in the active site
Class: electron transport
Keywords: electron transport
Deposited on 1993-01-28, released 1993-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AA25 (0-108)
      • insertion (32)
    Domains in SCOPe 2.07: d1thoa_
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1thoA (A:)
    sdkiihltddsfdtdvlkadgailvdfwaewcgrpckmiapildeiadeyqgkltvakln
    idqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla