PDB entry 1th0

View 1th0 on RCSB PDB site
Description: Structure of human Senp2
Class: cell cycle, hydrolase
Keywords: sumo; axam; senp; ulp; protease, cell cycle, hydrolase
Deposited on 2004-05-31, released 2004-09-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.21
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sentrin-specific protease 2
    Species: Homo sapiens [TaxId:9606]
    Gene: SENP2, KIAA1331
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1th0a_
  • Chain 'B':
    Compound: Sentrin-specific protease 2
    Species: Homo sapiens [TaxId:9606]
    Gene: SENP2, KIAA1331
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1th0b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1th0A (A:)
    dlleltedmekeisnalghgpqdeilssafklritrgdiqtlknyhwlndevinfymnll
    vernkkqgypalhvfstffypklksggyqavkrwtkgvnlfeqeiilvpihrkvhwslvv
    idlrkkclkyldsmgqkghriceillqylqdesktkrnsdlnllewthhsmkpheipqql
    ngsdcgmftckyadyisrdkpitftqhqmplfrkkmvweilhqqll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1th0B (B:)
    dlleltedmekeisnalghgpqdeilssafklritrgdiqtlknyhwlndevinfymnll
    vernkkqgypalhvfstffypklksggyqavkrwtkgvnlfeqeiilvpihrkvhwslvv
    idlrkkclkyldsmgqkghriceillqylqdesktkrnsdlnllewthhsmkpheipqql
    ngsdcgmftckyadyisrdkpitftqhqmplfrkkmvweilhqqll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1th0B (B:)
    eltedmekeisnalghgpqdeilssafklritrgdiqtlknyhwlndevinfymnllver
    nkkqgypalhvfstffypklksggyqavkrwtkgvnlfeqeiilvpihrkvhwslvvidl
    rkkclkyldsmgqkghriceillqylqdesktkrnsdlnllewthhsmkpheipqqlngs
    dcgmftckyadyisrdkpitftqhqmplfrkkmvweilhqqll