PDB entry 1tg6

View 1tg6 on RCSB PDB site
Description: Crystallography and mutagenesis point to an essential role for the N-terminus of human mitochondrial ClpP
Class: hydrolase
Keywords: mitochondrial ClpP, Clp/Hsp 100, ATP-dependent protease, HYDROLASE
Deposited on 2004-05-28, released 2005-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-11-30, with a file datestamp of 2016-11-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative ATP-dependent Clp protease proteolytic subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: CLPP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tg6a1
  • Chain 'B':
    Compound: Putative ATP-dependent Clp protease proteolytic subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: CLPP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tg6b_
  • Chain 'C':
    Compound: Putative ATP-dependent Clp protease proteolytic subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: CLPP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tg6c_
  • Chain 'D':
    Compound: Putative ATP-dependent Clp protease proteolytic subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: CLPP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tg6d_
  • Chain 'E':
    Compound: Putative ATP-dependent Clp protease proteolytic subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: CLPP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tg6e_
  • Chain 'F':
    Compound: Putative ATP-dependent Clp protease proteolytic subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: CLPP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tg6f_
  • Chain 'G':
    Compound: Putative ATP-dependent Clp protease proteolytic subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: CLPP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tg6g_
  • Heterogens: DIO, EDO, FME, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tg6A (A:)
    mwpgilvggarvascrypalgprlaahfpaqrppqrtlqnglalqrclhatatralplip
    ivveqtgrgeraydiysrllrerivcvmgpiddsvaslviaqllflqsesnkkpihmyin
    spggvvtaglaiydtmqyilnpictwcvgqaasmgslllaagtpgmrhslpnsrimihqp
    sggargqatdiaiqaeeimklkkqlyniyakhtkqslqviesamerdrymspmeaqefgi
    ldkvlvhppqdgedeptlvqkepveaapaaepvpast
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tg6A (A:)
    plipivvydiysrllrerivcvmgpiddsvaslviaqllflqsesnkkpihmyinspggv
    vtaglaiydtmqyilnpictwcvgqaasmgslllaagtpgmrhslpnsrimihqpsggar
    gqatdiaiqaeeimklkkqlyniyakhtkqslqviesamerdrymspmeaqefgildkvl
    vhpp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tg6B (B:)
    mwpgilvggarvascrypalgprlaahfpaqrppqrtlqnglalqrclhatatralplip
    ivveqtgrgeraydiysrllrerivcvmgpiddsvaslviaqllflqsesnkkpihmyin
    spggvvtaglaiydtmqyilnpictwcvgqaasmgslllaagtpgmrhslpnsrimihqp
    sggargqatdiaiqaeeimklkkqlyniyakhtkqslqviesamerdrymspmeaqefgi
    ldkvlvhppqdgedeptlvqkepveaapaaepvpast
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tg6B (B:)
    plipivvydiysrllrerivcvmgpiddsvaslviaqllflqsesnkkpihmyinspggv
    vtaglaiydtmqyilnpictwcvgqaasmgslllaagtpgmrhslpnsrimihqpsggar
    gqatdiaiqaeeimklkkqlyniyakhtkqslqviesamerdrymspmeaqefgildkvl
    vhp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1tg6C (C:)
    mwpgilvggarvascrypalgprlaahfpaqrppqrtlqnglalqrclhatatralplip
    ivveqtgrgeraydiysrllrerivcvmgpiddsvaslviaqllflqsesnkkpihmyin
    spggvvtaglaiydtmqyilnpictwcvgqaasmgslllaagtpgmrhslpnsrimihqp
    sggargqatdiaiqaeeimklkkqlyniyakhtkqslqviesamerdrymspmeaqefgi
    ldkvlvhppqdgedeptlvqkepveaapaaepvpast
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tg6C (C:)
    plipivvydiysrllrerivcvmgpiddsvaslviaqllflqsesnkkpihmyinspggv
    vtaglaiydtmqyilnpictwcvgqaasmgslllaagtpgmrhslpnsrimihqpsggar
    gqatdiaiqaeeimklkkqlyniyakhtkqslqviesamerdrymspmeaqefgildkvl
    vhp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1tg6D (D:)
    mwpgilvggarvascrypalgprlaahfpaqrppqrtlqnglalqrclhatatralplip
    ivveqtgrgeraydiysrllrerivcvmgpiddsvaslviaqllflqsesnkkpihmyin
    spggvvtaglaiydtmqyilnpictwcvgqaasmgslllaagtpgmrhslpnsrimihqp
    sggargqatdiaiqaeeimklkkqlyniyakhtkqslqviesamerdrymspmeaqefgi
    ldkvlvhppqdgedeptlvqkepveaapaaepvpast
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tg6D (D:)
    plipivvydiysrllrerivcvmgpiddsvaslviaqllflqsesnkkpihmyinspggv
    vtaglaiydtmqyilnpictwcvgqaasmgslllaagtpgmrhslpnsrimihqpsggar
    gqatdiaiqaeeimklkkqlyniyakhtkqslqviesamerdrymspmeaqefgildkvl
    vhpp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1tg6E (E:)
    mwpgilvggarvascrypalgprlaahfpaqrppqrtlqnglalqrclhatatralplip
    ivveqtgrgeraydiysrllrerivcvmgpiddsvaslviaqllflqsesnkkpihmyin
    spggvvtaglaiydtmqyilnpictwcvgqaasmgslllaagtpgmrhslpnsrimihqp
    sggargqatdiaiqaeeimklkkqlyniyakhtkqslqviesamerdrymspmeaqefgi
    ldkvlvhppqdgedeptlvqkepveaapaaepvpast
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tg6E (E:)
    plipivvydiysrllrerivcvmgpiddsvaslviaqllflqsesnkkpihmyinspggv
    vtaglaiydtmqyilnpictwcvgqaasmgslllaagtpgmrhslpnsrimihqpsggar
    gqatdiaiqaeeimklkkqlyniyakhtkqslqviesamerdrymspmeaqefgildkvl
    vhppqdgedeptlvqk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1tg6F (F:)
    mwpgilvggarvascrypalgprlaahfpaqrppqrtlqnglalqrclhatatralplip
    ivveqtgrgeraydiysrllrerivcvmgpiddsvaslviaqllflqsesnkkpihmyin
    spggvvtaglaiydtmqyilnpictwcvgqaasmgslllaagtpgmrhslpnsrimihqp
    sggargqatdiaiqaeeimklkkqlyniyakhtkqslqviesamerdrymspmeaqefgi
    ldkvlvhppqdgedeptlvqkepveaapaaepvpast
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tg6F (F:)
    plipivvydiysrllrerivcvmgpiddsvaslviaqllflqsesnkkpihmyinspggv
    vtaglaiydtmqyilnpictwcvgqaasmgslllaagtpgmrhslpnsrimihqpsggar
    gqatdiaiqaeeimklkkqlyniyakhtkqslqviesamerdrymspmeaqefgildkvl
    vhppqdg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1tg6G (G:)
    mwpgilvggarvascrypalgprlaahfpaqrppqrtlqnglalqrclhatatralplip
    ivveqtgrgeraydiysrllrerivcvmgpiddsvaslviaqllflqsesnkkpihmyin
    spggvvtaglaiydtmqyilnpictwcvgqaasmgslllaagtpgmrhslpnsrimihqp
    sggargqatdiaiqaeeimklkkqlyniyakhtkqslqviesamerdrymspmeaqefgi
    ldkvlvhppqdgedeptlvqkepveaapaaepvpast
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tg6G (G:)
    plipivvydiysrllrerivcvmgpiddsvaslviaqllflqsesnkkpihmyinspggv
    vtaglaiydtmqyilnpictwcvgqaasmgslllaagtpgmrhslpnsrimihqpsggar
    gqatdiaiqaeeimklkkqlyniyakhtkqslqviesamerdrymspmeaqefgildkvl
    vhppqdgedeptlv