PDB entry 1tg5

View 1tg5 on RCSB PDB site
Description: Crystal structures of plant 4-hydroxyphenylpyruvate dioxygenases complexed with DAS645
Class: oxidoreductase
Keywords: Arabidopsis thaliana, 4-hydroxyphenylpyruvate dioxygenase, HPPD, atHPPD, OXIDOREDUCTASE
Deposited on 2004-05-28, released 2004-08-17
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-05-09, with a file datestamp of 2012-05-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.191
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-hydroxyphenylpyruvate dioxygenase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: HPD, AT1G06570, F12K11.9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1tg5a1, d1tg5a2
  • Heterogens: FE2, 645, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tg5A (A:)
    mgfklvgfskfvrknpksdkfkvkrfhhiefwcgdatnvarrfswglgmrfsaksdlstg
    nmvhasylltsgdlrflftapyspslsageikptttasipsfdhgscrsffsshglgvra
    vaievedaesafsisvangaipssppivlneavtiaevklygdvvlryvsykaedtekse
    flpgfervedassfpldygirrldhavgnvpelgpaltyvagftgfhqfaeftaddvgta
    esglnsavlasndemvllpinepvhgtkrksqiqtylehnegaglqhlalmsedifrtlr
    emrkrssiggfdfmpsppptyyqnlkkrvgdvlsddqikeceelgilvdrddqgtllqif
    tkplgdrptifieiiqrvgcmmkdeegkayqsggcggfgkgnfselfksieeyektleak
    qlvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tg5A (A:)
    knpksdkfkvkrfhhiefwcgdatnvarrfswglgmrfsaksdlstgnmvhasylltsgd
    lrflftapyspslsageikptttasipsfdhgscrsffsshglgvravaievedaesafs
    isvangaipssppivlneavtiaevklygdvvlryvsykaseflpgfervedassfpldy
    girrldhavgnvpelgpaltyvagftgfhqfaesglnsavlasndemvllpinepvhgtk
    sqiqtylehnegaglqhlalmsedifrtlremrkrssiggfdfmpsppptyyqnlkkrvg
    dvlsddqikeceelgilvdrddqgtllqiftkplgdrptifieiiqrvgcyqsggcggfg
    kgnfselfksi