PDB entry 1tfz

View 1tfz on RCSB PDB site
Description: Structural basis for herbicidal inhibitor selectivity revealed by comparison of crystal structures of plant and mammalian 4-hydroxyphenylpyruvate dioxygenases
Class: oxidoreductase
Keywords: Arabidopsis thaliana, 4-hydroxyphenylpyruvate dioxygenase, HPPD, atHPPD, OXIDOREDUCTASE
Deposited on 2004-05-27, released 2004-08-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.22
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-hydroxyphenylpyruvate dioxygenase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1tfza1, d1tfza2
  • Heterogens: FE, 869, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tfzA (A:)
    mgfklvgfskfvrknpksdkfkvkrfhhiefwcgdatnvarrfswglgmrfsaksdlstg
    nmvhasylltsgdlrflftapyspslsageikptttasipsfdhgscrsffsshglgvra
    vaievedaesafsisvangaipssppivlneavtiaevklygdvvlryvsykaedtekse
    flpgfervedassfpldygirrldhavgnvpelgpaltyvagftgfhqfaeftaddvgta
    esglnsavlasndemvllpinepvhgtkrksqiqtylehnegaglqhlalmsedifrtlr
    emrkrssiggfdfmpsppptyyqnlkkrvgdvlsddqikeceelgilvdrddqgtllqif
    tkplgdrptifieiiqrvgcmmkdeegkayqsggcggfgkgnfselfksieeyektleak
    qlvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tfzA (A:)
    npksdkfkvkrfhhiefwcgdatnvarrfswglgmrfsaksdlstgnmvhasylltsgdl
    rflftapyspslsageikptttasipsfdhgscrsffsshglgvravaievedaesafsi
    svangaipssppivlneavtiaevklygdvvlryvsykeflpgfervedassfpldygir
    rldhavgnvpelgpaltyvagftgfhqfasglnsavlasndemvllpinepvhgksqiqt
    ylehnegaglqhlalmsedifrtlremrkrssiggfdfmpsppptyyqnlkkrvgdvlsd
    dqikeceelgilvdrddqgtllqiftkplgdrptifieiiqrvgcmqsggcggfgkgnfs
    elfk