PDB entry 1tfh

View 1tfh on RCSB PDB site
Description: extracellular domain of human tissue factor
Class: coagulation factor
Keywords: blood coagulation, tissue factor, coagulation factor, glycoprotein
Deposited on 1997-04-10, released 1998-02-25
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.217
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: human tissue factor
    Species: Homo sapiens [TaxId:9606]
    Gene: HUMAN TISSUE FACTOR EXTRACELLU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1tfha1, d1tfha2
  • Chain 'B':
    Compound: human tissue factor
    Species: Homo sapiens [TaxId:9606]
    Gene: HUMAN TISSUE FACTOR EXTRACELLU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1tfhb1, d1tfhb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tfhA (A:)
    sgttntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdlt
    deivkdvkqtylarvfsypagnvestgsageplyenspeftpyletnlgqptiqsfeqvg
    tkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkktaktntneflidvd
    kgenycfsvqavipsrtvnrkstdspvecmgqekgefre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tfhA (A:)
    ntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeiv
    kdvkqtylarvfsypagnvageplyenspeftpyletnlgqptiqsfeqvgtkvnvtved
    ertlvrrnntflslrdvfgkdliytlyywkssssgkktaktntneflidvdkgenycfsv
    qavipsrtvnrkstdspvecmg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tfhB (B:)
    sgttntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdlt
    deivkdvkqtylarvfsypagnvestgsageplyenspeftpyletnlgqptiqsfeqvg
    tkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkktaktntneflidvd
    kgenycfsvqavipsrtvnrkstdspvecmgqekgefre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tfhB (B:)
    ntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeiv
    kdvkqtylarvfsypagnveplyenspeftpyletnlgqptiqstkvnvtvedertlvnt
    flslrdvfgkdliytlyygkktaktntneflidvdkgcfsvqavipsrtvnrkstdspve
    cm