PDB entry 1tfg

View 1tfg on RCSB PDB site
Description: an unusual feature revealed by the crystal structure at 2.2 angstroms resolution of human transforming growth factor-beta2
Class: growth factor
Keywords: growth factor
Deposited on 1992-11-17, released 1993-10-31
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.194
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transforming growth factor, beta 2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1tfga_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tfgA (A:)
    aldaaycfrnvqdncclrplyidfkrdlgwkwihepkgynanfcagacpylwssdtqhsr
    vlslyntinpeasaspccvsqdlepltilyyigktpkieqlsnmivksckcs