PDB entry 1tff

View 1tff on RCSB PDB site
Description: Structure of Otubain-2
Class: hydrolase
Keywords: hydrolase
Deposited on 2004-05-27, released 2004-08-03
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.191
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin thiolesterase protein OTUB2
    Species: Homo sapiens [TaxId:9606]
    Gene: OTUB2, OTB2, OTU2, C14ORF137
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96DC9 (Start-233)
      • engineered (48)
      • modified residue (157)
      • modified residue (170)
    Domains in SCOPe 2.04: d1tffa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tffA (A:)
    msetsfnlisekcdilsilrdhpenriyrrkieelskrftairktkgdrncfyralgysy
    lesllgksreifkfkervlqtpndllaagfeehkfrnffnafysvvelvekdgsvssllk
    vfndqsasdhivqflrlltsafirnradffrhfideemdikdfcthevepmatecdhiqi
    talsqalsialqveyvdemdtalnhhvfpeaatpsvyllyktshynilyaadkh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tffA (A:)
    nlisekcdilsilrdhpenriyrrkieelskrftairktkgdrncfyralgysylesllg
    ksreifkfkervlqtpndllaagfeehkfrnffnafysvvelvekdgsvssllkvfndqs
    asdhivqflrlltsafirnradffrhfideemdikdfcthevepmatecdhiqitalsqa
    lsialqveyvdhhvfpeaatpsvyllyktshynilyaadkh