PDB entry 1tff

View 1tff on RCSB PDB site
Description: structure of otubain-2
Deposited on 2004-05-27, released 2004-08-03
The last revision prior to the SCOP 1.71 freeze date was dated 2004-08-10, with a file datestamp of 2004-08-10.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.191
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1tffa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tffA (A:)
    msetsfnlisekcdilsilrdhpenriyrrkieelskrftairktkgdrncfyralgysy
    lesllgksreifkfkervlqtpndllaagfeehkfrnffnafysvvelvekdgsvssllk
    vfndqsasdhivqflrlltsafirnradffrhfideemdikdfcthevepmatecdhiqi
    talsqalsialqveyvdemdtalnhhvfpeaatpsvyllyktshynilyaadkh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tffA (A:)
    nlisekcdilsilrdhpenriyrrkieelskrftairktkgdrncfyralgysylesllg
    ksreifkfkervlqtpndllaagfeehkfrnffnafysvvelvekdgsvssllkvfndqs
    asdhivqflrlltsafirnradffrhfideemdikdfcthevepmatecdhiqitalsqa
    lsialqveyvdhhvfpeaatpsvyllyktshynilyaadkh