PDB entry 1tet

View 1tet on RCSB PDB site
Description: crystal structure of an anticholera toxin peptide complex at 2.3 angstroms
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1993-06-21, released 1994-01-31
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.148
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: igg1 te33 fab (heavy chain)
    Species: Mus musculus
    Database cross-references and differences (RAF-indexed):
    • GB AAB53773 (0-209)
      • conflict (12)
      • conflict (25)
      • conflict (27)
      • conflict (29)
      • conflict (31)
      • conflict (34)
      • conflict (37)
      • conflict (39)
      • conflict (44)
      • conflict (47)
      • conflict (50)
      • conflict (53)
      • conflict (58)
      • conflict (61)
      • conflict (76)
      • conflict (97-98)
      • insertion (103-104)
      • conflict (107)
      • conflict (111)
      • conflict (183-184)
    Domains in SCOP 1.75: d1teth1, d1teth2
  • Chain 'L':
    Compound: igg1 te33 fab (light chain)
    Species: Mus musculus
    Database cross-references and differences (RAF-indexed):
    • PIR PC4203 (0-215)
      • conflict (23)
      • conflict (30)
      • conflict (37)
      • conflict (98)
      • conflict (100)
      • conflict (104)
      • conflict (192)
    Domains in SCOP 1.75: d1tetl1, d1tetl2
  • Chain 'P':
    Compound: cholera toxin peptide 3 (ctp3)
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CIT, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tetH (H:)
    qiqlvqsgpelktpgetvrisckasgytfttygmswvkqtpgkgfkwmgwintysgvpty
    addfkgrfafsletsastaylqinnlknedtatyfcarrswyfdvwgtgttvtvssaktt
    ppsvyplapgsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssvtv
    pssprpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tetL (L:)
    dvlmtqtplslpvslgdqasisckssqsivhssgntyfewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshipftfgsgtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyewhnsytceathktstspivksfnr
    

  • Chain 'P':
    No sequence available.