PDB entry 1tet

View 1tet on RCSB PDB site
Description: crystal structure of an anticholera toxin peptide complex at 2.3 angstroms
Deposited on 1993-06-21, released 1994-01-31
The last revision prior to the SCOP 1.55 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.3 Å
R-factor: 0.148
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tetH (H:)
    qiqlvqsgpelktpgetvrisckasgytfttygmswvkqtpgkgfkwmgwintysgvpty
    addfkgrfafsletsastaylqinnlknedtatyfcarrswyfdvwgtgttvtvssaktt
    ppsvyplapgsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssvtv
    pssprpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tetL (L:)
    dvlmtqtplslpvslgdqasisckssqsivhssgntyfewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshipftfgsgtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyewhnsytceathktstspivksfnr