PDB entry 1tel

View 1tel on RCSB PDB site
Description: Crystal structure of a RubisCO-like protein from Chlorobium tepidum
Class: structural genomics, unknown function
Keywords: Structural genomics, RubisCO-like protein, unknown function, NYSGXRC, target 1798, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics
Deposited on 2004-05-25, released 2004-10-05
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.209
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribulose bisphosphate carboxylase, large subunit
    Species: Chlorobaculum tepidum [TaxId:194439]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1tela1, d1tela2
  • Chain 'B':
    Compound: ribulose bisphosphate carboxylase, large subunit
    Species: Chlorobaculum tepidum [TaxId:194439]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1telb1, d1telb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1telA (A:)
    mnaedvkgffasresldmeqylvldyylesvgdietalahfcseqstaqwkrvgvdedfr
    lvhaakvidyevieeleqlsypvkhsetgkihacrvtiahphcnfgpkipnlltavcgeg
    tyftpgvpvvklmdihfpdtyladfegpkfgieglrdilnahgrpiffgvvkpniglspg
    efaeiayqswlggldiakddemladvtwssieeraahlgkarrkaeaetgepkiylanit
    devdslmekhdvavrnganallinalpvglsavrmlsnytqvplighfpfiasfsrmeky
    gihskvmtklqrlagldavimpgfgdrmmtpeeevlenviectkpmgrikpclpvpggsd
    saltlqtvyekvgnvdfgfvpgrgvfghpmgpkagaksirqaweaieqgisietwaethp
    elqamvdqsllkkqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1telA (A:)
    mnaedvkgffasresldmeqylvldyylesvgdietalahfcseqstaqwkrvgvdedfr
    lvhaakvidyevieeleqlsypvkgkihacrvtiahphcnfgpkipnlltavcgegtyft
    pgvpvvklmdihfpdtyladfegpkfgieglrdilnahgrpiffgvvkpniglspgefae
    iayqswlggldiakddemladvtwssieeraahlgkarrkaeaetgepkiylanitdevd
    slmekhdvavrnganallinalpvglsavrmlsnytqvplighfpfiasfsrmekygihs
    kvmtklqrlagldavimpgfgdrmmtpeeevlenviectkpmgrikpclpvpggsdsalt
    lqtvyekvgnvdfgfvpgrgvfghpmgpkagaksirqaweaieqgisietwaethpelqa
    mvdq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1telB (B:)
    mnaedvkgffasresldmeqylvldyylesvgdietalahfcseqstaqwkrvgvdedfr
    lvhaakvidyevieeleqlsypvkhsetgkihacrvtiahphcnfgpkipnlltavcgeg
    tyftpgvpvvklmdihfpdtyladfegpkfgieglrdilnahgrpiffgvvkpniglspg
    efaeiayqswlggldiakddemladvtwssieeraahlgkarrkaeaetgepkiylanit
    devdslmekhdvavrnganallinalpvglsavrmlsnytqvplighfpfiasfsrmeky
    gihskvmtklqrlagldavimpgfgdrmmtpeeevlenviectkpmgrikpclpvpggsd
    saltlqtvyekvgnvdfgfvpgrgvfghpmgpkagaksirqaweaieqgisietwaethp
    elqamvdqsllkkqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1telB (B:)
    mnaedvkgffasresldmeqylvldyylesvgdietalahfcseqstaqwkrvgvdedfr
    lvhaakvidyevieeleqlsypvkhsetgkihacrvtiahphcnfgpkipnlltavcgeg
    tyftpgvpvvklmdihfpdtyladfegpkfgieglrdilnahgrpiffgvvkpniglspg
    efaeiayqswlggldiakddemladvtwssieeraahlgkarrkaeaetgepkiylanit
    devdslmekhdvavrnganallinalpvglsavrmlsnytqvplighfpfiasfsrmeky
    gihskvmtklqrlagldavimpgfgdrmmtpeeevlenviectkpmgrikpclpvpggsd
    saltlqtvyekvgnvdfgfvpgrgvfghpmgpkagaksirqaweaieqgisietwaethp
    elqamvdq