PDB entry 1tee

View 1tee on RCSB PDB site
Description: Crystal structure of C205F mutant of PKS18 from Mycobacterium tuberculosis
Class: transferase
Keywords: thiolase fold, substrate binding tunnel, TRANSFERASE
Deposited on 2004-05-25, released 2004-08-03
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.221
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pks18
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: pks18
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7D8I1 (Start-392)
      • engineered (204)
    Domains in SCOPe 2.04: d1teea1, d1teea2
  • Chain 'B':
    Compound: pks18
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: pks18
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7D8I1 (Start-392)
      • engineered (204)
    Domains in SCOPe 2.04: d1teeb1, d1teeb2
  • Chain 'C':
    Compound: pks18
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: pks18
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7D8I1 (Start-392)
      • engineered (204)
    Domains in SCOPe 2.04: d1teec1, d1teec2
  • Chain 'D':
    Compound: pks18
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: pks18
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7D8I1 (Start-392)
      • engineered (204)
    Domains in SCOPe 2.04: d1teed1, d1teed2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1teeA (A:)
    mnvsaesgaprragqrhevglaqlppappttvavieglatgtprrvvnqsdaadrvaelf
    ldpgqreriprvyqksrittrrmavdpldakfdvfrrepatirdrmhlfyehavplavdv
    skralaglpyraaeigllvlatstgfiapgvdvaivkelglspsisrvvvnfmgcaaamn
    algtatnyvrahpamkalvvcielfsvnavfaddindvvihslfgdgcaalvigasqvqe
    klepgkvvvrssfsqlldntedgivlgvnhngitcelsenlpgyifsgvapvvtemlwdn
    glqisdidlwaihpggpkiieqsvrslgisaelaaqswdvlarfgnmlsvslifvletmv
    qqaesakaistgvafafgpgvtvegmlfdiirr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1teeA (A:)
    aqlppappttvavieglatgtprrvvnqsdaadrvaelgqreriprvyqksrittrrmav
    dpldakfdvfrrepatirdrmhlfyehavplavdvskralaglpyraaeigllvlatstg
    fiapgvdvaivkelglspsisrvvvnfmgcaaamnalgtatnyvrahpamkalvvcielf
    svnavfaddindvvihslfgdgcaalvigasqvqeklepgkvvvrssfsqlldntedgiv
    lgvnhngitcelsenlpgyifsgvapvvtemlwdnglqisdidlwaihpggpkiieqsvr
    slgisaelaaqswdvlarfgnmlsvslifvletmvqqaesakaistgvafafgpgvtveg
    mlfdiirr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1teeB (B:)
    mnvsaesgaprragqrhevglaqlppappttvavieglatgtprrvvnqsdaadrvaelf
    ldpgqreriprvyqksrittrrmavdpldakfdvfrrepatirdrmhlfyehavplavdv
    skralaglpyraaeigllvlatstgfiapgvdvaivkelglspsisrvvvnfmgcaaamn
    algtatnyvrahpamkalvvcielfsvnavfaddindvvihslfgdgcaalvigasqvqe
    klepgkvvvrssfsqlldntedgivlgvnhngitcelsenlpgyifsgvapvvtemlwdn
    glqisdidlwaihpggpkiieqsvrslgisaelaaqswdvlarfgnmlsvslifvletmv
    qqaesakaistgvafafgpgvtvegmlfdiirr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1teeB (B:)
    tvavieglatgtprrvvnqsdaadrvaelgqreriprvyqksrittrrmavdpldakfdv
    frrepatirdrmhlfyehavplavdvskralaglpyraaeigllvlatstgfiapgvdva
    ivkelglspsisrvvvnfmgcaaamnalgtatnyvrahpamkalvvcielfsvnavfadd
    indvvihslfgdgcaalvigasqvqeklepgkvvvrssfsqlldntedgivlgvnhngit
    celsenlpgyifsgvapvvtemlwdnglqisdidlwaihpggpkiieqsvrslgisaela
    aqswdvlarfgnmlsvslifvletmvqqaesakaistgvafafgpgvtvegmlfdiirr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1teeC (C:)
    mnvsaesgaprragqrhevglaqlppappttvavieglatgtprrvvnqsdaadrvaelf
    ldpgqreriprvyqksrittrrmavdpldakfdvfrrepatirdrmhlfyehavplavdv
    skralaglpyraaeigllvlatstgfiapgvdvaivkelglspsisrvvvnfmgcaaamn
    algtatnyvrahpamkalvvcielfsvnavfaddindvvihslfgdgcaalvigasqvqe
    klepgkvvvrssfsqlldntedgivlgvnhngitcelsenlpgyifsgvapvvtemlwdn
    glqisdidlwaihpggpkiieqsvrslgisaelaaqswdvlarfgnmlsvslifvletmv
    qqaesakaistgvafafgpgvtvegmlfdiirr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1teeC (C:)
    aqlppappttvavieglatgtprrvvnqsdaadrvaelgqreriprvyqksrittrrmav
    dpldakfdvfrrepatirdrmhlfyehavplavdvskralaglpyraaeigllvlatstg
    fiapgvdvaivkelglspsisrvvvnfmgcaaamnalgtatnyvrahpamkalvvcielf
    svnavfaddindvvihslfgdgcaalvigasqvqeklepgkvvvrssfsqlldntedgiv
    lgvnhngitcelsenlpgyifsgvapvvtemlwdnglqisdidlwaihpggpkiieqsvr
    slgisaelaaqswdvlarfgnmlsvslifvletmvqqaesakaistgvafafgpgvtveg
    mlfdiirr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1teeD (D:)
    mnvsaesgaprragqrhevglaqlppappttvavieglatgtprrvvnqsdaadrvaelf
    ldpgqreriprvyqksrittrrmavdpldakfdvfrrepatirdrmhlfyehavplavdv
    skralaglpyraaeigllvlatstgfiapgvdvaivkelglspsisrvvvnfmgcaaamn
    algtatnyvrahpamkalvvcielfsvnavfaddindvvihslfgdgcaalvigasqvqe
    klepgkvvvrssfsqlldntedgivlgvnhngitcelsenlpgyifsgvapvvtemlwdn
    glqisdidlwaihpggpkiieqsvrslgisaelaaqswdvlarfgnmlsvslifvletmv
    qqaesakaistgvafafgpgvtvegmlfdiirr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1teeD (D:)
    tvavieglatgtprrvvnqsdaadrvaelgqreriprvyqksrittrrmavdpldakfdv
    frrepatirdrmhlfyehavplavdvskralaglpyraaeigllvlatstgfiapgvdva
    ivkelglspsisrvvvnfmgcaaamnalgtatnyvrahpamkalvvcielfsvnavfadd
    indvvihslfgdgcaalvigasqvqeklepgkvvvrssfsqlldntedgivlgvnhngit
    celsenlpgyifsgvapvvtemlwdnglqisdidlwaihpggpkiieqsvrslgisaela
    aqswdvlarfgnmlsvslifvletmvqqaesakaistgvafafgpgvtvegmlfdiirr