PDB entry 1tee

View 1tee on RCSB PDB site
Description: Crystal structure of C205F mutant of PKS18 from Mycobacterium tuberculosis
Deposited on 2004-05-25, released 2004-08-03
The last revision prior to the SCOP 1.69 freeze date was dated 2004-09-21, with a file datestamp of 2004-09-21.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.221
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1teea_
  • Chain 'B':
    Domains in SCOP 1.69: d1teeb_
  • Chain 'C':
    Domains in SCOP 1.69: d1teec_
  • Chain 'D':
    Domains in SCOP 1.69: d1teed_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1teeA (A:)
    mnvsaesgaprragqrhevglaqlppappttvavieglatgtprrvvnqsdaadrvaelf
    ldpgqreriprvyqksrittrrmavdpldakfdvfrrepatirdrmhlfyehavplavdv
    skralaglpyraaeigllvlatstgfiapgvdvaivkelglspsisrvvvnfmgcaaamn
    algtatnyvrahpamkalvvcielfsvnavfaddindvvihslfgdgcaalvigasqvqe
    klepgkvvvrssfsqlldntedgivlgvnhngitcelsenlpgyifsgvapvvtemlwdn
    glqisdidlwaihpggpkiieqsvrslgisaelaaqswdvlarfgnmlsvslifvletmv
    qqaesakaistgvafafgpgvtvegmlfdiirr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1teeA (A:)
    aqlppappttvavieglatgtprrvvnqsdaadrvaelgqreriprvyqksrittrrmav
    dpldakfdvfrrepatirdrmhlfyehavplavdvskralaglpyraaeigllvlatstg
    fiapgvdvaivkelglspsisrvvvnfmgcaaamnalgtatnyvrahpamkalvvcielf
    svnavfaddindvvihslfgdgcaalvigasqvqeklepgkvvvrssfsqlldntedgiv
    lgvnhngitcelsenlpgyifsgvapvvtemlwdnglqisdidlwaihpggpkiieqsvr
    slgisaelaaqswdvlarfgnmlsvslifvletmvqqaesakaistgvafafgpgvtveg
    mlfdiirr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1teeB (B:)
    mnvsaesgaprragqrhevglaqlppappttvavieglatgtprrvvnqsdaadrvaelf
    ldpgqreriprvyqksrittrrmavdpldakfdvfrrepatirdrmhlfyehavplavdv
    skralaglpyraaeigllvlatstgfiapgvdvaivkelglspsisrvvvnfmgcaaamn
    algtatnyvrahpamkalvvcielfsvnavfaddindvvihslfgdgcaalvigasqvqe
    klepgkvvvrssfsqlldntedgivlgvnhngitcelsenlpgyifsgvapvvtemlwdn
    glqisdidlwaihpggpkiieqsvrslgisaelaaqswdvlarfgnmlsvslifvletmv
    qqaesakaistgvafafgpgvtvegmlfdiirr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1teeB (B:)
    tvavieglatgtprrvvnqsdaadrvaelgqreriprvyqksrittrrmavdpldakfdv
    frrepatirdrmhlfyehavplavdvskralaglpyraaeigllvlatstgfiapgvdva
    ivkelglspsisrvvvnfmgcaaamnalgtatnyvrahpamkalvvcielfsvnavfadd
    indvvihslfgdgcaalvigasqvqeklepgkvvvrssfsqlldntedgivlgvnhngit
    celsenlpgyifsgvapvvtemlwdnglqisdidlwaihpggpkiieqsvrslgisaela
    aqswdvlarfgnmlsvslifvletmvqqaesakaistgvafafgpgvtvegmlfdiirr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1teeC (C:)
    mnvsaesgaprragqrhevglaqlppappttvavieglatgtprrvvnqsdaadrvaelf
    ldpgqreriprvyqksrittrrmavdpldakfdvfrrepatirdrmhlfyehavplavdv
    skralaglpyraaeigllvlatstgfiapgvdvaivkelglspsisrvvvnfmgcaaamn
    algtatnyvrahpamkalvvcielfsvnavfaddindvvihslfgdgcaalvigasqvqe
    klepgkvvvrssfsqlldntedgivlgvnhngitcelsenlpgyifsgvapvvtemlwdn
    glqisdidlwaihpggpkiieqsvrslgisaelaaqswdvlarfgnmlsvslifvletmv
    qqaesakaistgvafafgpgvtvegmlfdiirr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1teeC (C:)
    aqlppappttvavieglatgtprrvvnqsdaadrvaelgqreriprvyqksrittrrmav
    dpldakfdvfrrepatirdrmhlfyehavplavdvskralaglpyraaeigllvlatstg
    fiapgvdvaivkelglspsisrvvvnfmgcaaamnalgtatnyvrahpamkalvvcielf
    svnavfaddindvvihslfgdgcaalvigasqvqeklepgkvvvrssfsqlldntedgiv
    lgvnhngitcelsenlpgyifsgvapvvtemlwdnglqisdidlwaihpggpkiieqsvr
    slgisaelaaqswdvlarfgnmlsvslifvletmvqqaesakaistgvafafgpgvtveg
    mlfdiirr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1teeD (D:)
    mnvsaesgaprragqrhevglaqlppappttvavieglatgtprrvvnqsdaadrvaelf
    ldpgqreriprvyqksrittrrmavdpldakfdvfrrepatirdrmhlfyehavplavdv
    skralaglpyraaeigllvlatstgfiapgvdvaivkelglspsisrvvvnfmgcaaamn
    algtatnyvrahpamkalvvcielfsvnavfaddindvvihslfgdgcaalvigasqvqe
    klepgkvvvrssfsqlldntedgivlgvnhngitcelsenlpgyifsgvapvvtemlwdn
    glqisdidlwaihpggpkiieqsvrslgisaelaaqswdvlarfgnmlsvslifvletmv
    qqaesakaistgvafafgpgvtvegmlfdiirr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1teeD (D:)
    tvavieglatgtprrvvnqsdaadrvaelgqreriprvyqksrittrrmavdpldakfdv
    frrepatirdrmhlfyehavplavdvskralaglpyraaeigllvlatstgfiapgvdva
    ivkelglspsisrvvvnfmgcaaamnalgtatnyvrahpamkalvvcielfsvnavfadd
    indvvihslfgdgcaalvigasqvqeklepgkvvvrssfsqlldntedgivlgvnhngit
    celsenlpgyifsgvapvvtemlwdnglqisdidlwaihpggpkiieqsvrslgisaela
    aqswdvlarfgnmlsvslifvletmvqqaesakaistgvafafgpgvtvegmlfdiirr