PDB entry 1ted

View 1ted on RCSB PDB site
Description: Crystal structure of a type III polyketide synthase PKS18 from Mycobacterium tuberculosis
Class: transferase
Keywords: thiolase fold, substrate binding tunnel, TRANSFERASE
Deposited on 2004-05-25, released 2004-08-03
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.205
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pks18
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: pks18
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1teda1, d1teda2
  • Chain 'B':
    Compound: pks18
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: pks18
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1tedb1, d1tedb2
  • Chain 'C':
    Compound: pks18
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: pks18
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1tedc1, d1tedc2
  • Chain 'D':
    Compound: pks18
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: pks18
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1tedd1, d1tedd2
  • Heterogens: MYR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tedA (A:)
    mnvsaesgaprragqrhevglaqlppappttvavieglatgtprrvvnqsdaadrvaelf
    ldpgqreriprvyqksrittrrmavdpldakfdvfrrepatirdrmhlfyehavplavdv
    skralaglpyraaeigllvlatstgfiapgvdvaivkelglspsisrvvvnfmgcaaamn
    algtatnyvrahpamkalvvcielcsvnavfaddindvvihslfgdgcaalvigasqvqe
    klepgkvvvrssfsqlldntedgivlgvnhngitcelsenlpgyifsgvapvvtemlwdn
    glqisdidlwaihpggpkiieqsvrslgisaelaaqswdvlarfgnmlsvslifvletmv
    qqaesakaistgvafafgpgvtvegmlfdiirr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tedA (A:)
    aqlppappttvavieglatgtprrvvnqsdaadrvaelgqreriprvyqksrittrrmav
    dpldakfdvfrrepatirdrmhlfyehavplavdvskralaglpyraaeigllvlatstg
    fiapgvdvaivkelglspsisrvvvnfmgcaaamnalgtatnyvrahpamkalvvcielc
    svnavfaddindvvihslfgdgcaalvigasqvqeklepgkvvvrssfsqlldntedgiv
    lgvnhngitcelsenlpgyifsgvapvvtemlwdnglqisdidlwaihpggpkiieqsvr
    slgisaelaaqswdvlarfgnmlsvslifvletmvqqaesakaistgvafafgpgvtveg
    mlfdiirr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tedB (B:)
    mnvsaesgaprragqrhevglaqlppappttvavieglatgtprrvvnqsdaadrvaelf
    ldpgqreriprvyqksrittrrmavdpldakfdvfrrepatirdrmhlfyehavplavdv
    skralaglpyraaeigllvlatstgfiapgvdvaivkelglspsisrvvvnfmgcaaamn
    algtatnyvrahpamkalvvcielcsvnavfaddindvvihslfgdgcaalvigasqvqe
    klepgkvvvrssfsqlldntedgivlgvnhngitcelsenlpgyifsgvapvvtemlwdn
    glqisdidlwaihpggpkiieqsvrslgisaelaaqswdvlarfgnmlsvslifvletmv
    qqaesakaistgvafafgpgvtvegmlfdiirr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tedB (B:)
    tvavieglatgtprrvvnqsdaadrvaelgqreriprvyqksrittrrmavdpldakfdv
    frrepatirdrmhlfyehavplavdvskralaglpyraaeigllvlatstgfiapgvdva
    ivkelglspsisrvvvnfmgcaaamnalgtatnyvrahpamkalvvcielcsvnavfadd
    indvvihslfgdgcaalvigasqvqeklepgkvvvrssfsqlldntedgivlgvnhngit
    celsenlpgyifsgvapvvtemlwdnglqisdidlwaihpggpkiieqsvrslgisaela
    aqswdvlarfgnmlsvslifvletmvqqaesakaistgvafafgpgvtvegmlfdiirr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1tedC (C:)
    mnvsaesgaprragqrhevglaqlppappttvavieglatgtprrvvnqsdaadrvaelf
    ldpgqreriprvyqksrittrrmavdpldakfdvfrrepatirdrmhlfyehavplavdv
    skralaglpyraaeigllvlatstgfiapgvdvaivkelglspsisrvvvnfmgcaaamn
    algtatnyvrahpamkalvvcielcsvnavfaddindvvihslfgdgcaalvigasqvqe
    klepgkvvvrssfsqlldntedgivlgvnhngitcelsenlpgyifsgvapvvtemlwdn
    glqisdidlwaihpggpkiieqsvrslgisaelaaqswdvlarfgnmlsvslifvletmv
    qqaesakaistgvafafgpgvtvegmlfdiirr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tedC (C:)
    aqlppappttvavieglatgtprrvvnqsdaadrvaelgqreriprvyqksrittrrmav
    dpldakfdvfrrepatirdrmhlfyehavplavdvskralaglpyraaeigllvlatstg
    fiapgvdvaivkelglspsisrvvvnfmgcaaamnalgtatnyvrahpamkalvvcielc
    svnavfaddindvvihslfgdgcaalvigasqvqeklepgkvvvrssfsqlldntedgiv
    lgvnhngitcelsenlpgyifsgvapvvtemlwdnglqisdidlwaihpggpkiieqsvr
    slgisaelaaqswdvlarfgnmlsvslifvletmvqqaesakaistgvafafgpgvtveg
    mlfdiirr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1tedD (D:)
    mnvsaesgaprragqrhevglaqlppappttvavieglatgtprrvvnqsdaadrvaelf
    ldpgqreriprvyqksrittrrmavdpldakfdvfrrepatirdrmhlfyehavplavdv
    skralaglpyraaeigllvlatstgfiapgvdvaivkelglspsisrvvvnfmgcaaamn
    algtatnyvrahpamkalvvcielcsvnavfaddindvvihslfgdgcaalvigasqvqe
    klepgkvvvrssfsqlldntedgivlgvnhngitcelsenlpgyifsgvapvvtemlwdn
    glqisdidlwaihpggpkiieqsvrslgisaelaaqswdvlarfgnmlsvslifvletmv
    qqaesakaistgvafafgpgvtvegmlfdiirr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tedD (D:)
    tvavieglatgtprrvvnqsdaadrvaelgqreriprvyqksrittrrmavdpldakfdv
    frrepatirdrmhlfyehavplavdvskralaglpyraaeigllvlatstgfiapgvdva
    ivkelglspsisrvvvnfmgcaaamnalgtatnyvrahpamkalvvcielcsvnavfadd
    indvvihslfgdgcaalvigasqvqeklepgkvvvrssfsqlldntedgivlgvnhngit
    celsenlpgyifsgvapvvtemlwdnglqisdidlwaihpggpkiieqsvrslgisaela
    aqswdvlarfgnmlsvslifvletmvqqaesakaistgvafafgpgvtvegmlfdiirr