PDB entry 1te7

View 1te7 on RCSB PDB site
Description: solution nmr structure of protein yqfb from escherichia coli. northeast structural genomics consortium target et99
Deposited on 2004-05-24, released 2005-01-04
The last revision prior to the SCOP 1.71 freeze date was dated 2005-01-04, with a file datestamp of 2005-01-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1te7a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1te7A (A:)
    mqpnditffqrfqddilagrktitirdeseshfktgdvlrvgrfeddgyfctievtatst
    vtldtltekhaeqenmtltelkkviadiypgqtqfyviefkcl