PDB entry 1tdy

View 1tdy on RCSB PDB site
Description: dissection of the functional role of structural elements of tyrosine- 63 in the catalytic action of human lysozyme
Deposited on 1992-08-06, released 1993-01-15
The last revision prior to the SCOP 1.67 freeze date was dated 1993-01-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.7 Å
R-factor: 0.181
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.67: d1tdy__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1tdy_ (-)
  kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
  srwwcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
  vrqyvqgcgv