PDB entry 1td7

View 1td7 on RCSB PDB site
Description: Interactions of a specific non-steroidal anti-inflammatory drug (NSAID) with group I phospholipase A2 (PLA2): Crystal structure of the complex formed between PLA2 and niflumic acid at 2.5 A resolution
Class: hydrolase
Keywords: Phospholipase A2, Enzyme, Inhibitor, hydrolase
Deposited on 2004-05-21, released 2004-06-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.195
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Phospholipase A2 isoform 3
  Species: Naja sagittifera [TaxId:195058]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P60045 (0-118)
  Domains in SCOPe 2.08: d1td7a_
• Heterogens: CA, NFL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1td7A (A:)
  nlyqfknmiqctvpsrswqdfadygcycgkggsgtpvddldrccqvhdncyneaenisgc
  rpyfktysyectqgtltckgdnnacaasvcdcdrlaaicfagapyndanynidlkarcn