PDB entry 1td1

View 1td1 on RCSB PDB site
Description: Crystal Structure of the Purine Nucleoside Phosphorylase from Schistosoma mansoni in complex with acetate
Class: transferase
Keywords: Purine Nucleoside Phosphorylase, TRANSFERASE
Deposited on 2004-05-21, released 2005-05-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.188
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: purine-nucleoside phosphorylase
    Species: Schistosoma mansoni [TaxId:6183]
    Gene: SmPNP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1td1a_
  • Chain 'B':
    Compound: purine-nucleoside phosphorylase
    Species: Schistosoma mansoni [TaxId:6183]
    Gene: SmPNP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1td1b_
  • Chain 'C':
    Compound: purine-nucleoside phosphorylase
    Species: Schistosoma mansoni [TaxId:6183]
    Gene: SmPNP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1td1c_
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1td1A (A:)
    mhesvtanienvkkvahhiqkltsivpeigiicgsglgkladgvkdkitipytkipnfpq
    tsvvghsgnlifgtlsgrkvvvmqgrfhmyegysndtvalpirvmkllgvkilmvsnaag
    glnrslklgdfvilkdhiylpglglnnilvgpnqeafgtrfpalsnaydrdlrklavqva
    eengfgnlvhqgvyvmnggpcyetpaectmllnmgcdvvgmstipevviarhcgiqvfav
    slvtnisvldvesdlkpnheevlatgaqraelmqswfekiieklpkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1td1A (A:)
    esvtanienvkkvahhiqkltsivpeigiicgsglgkladgvkdkitipytkipnfpqts
    hsgnlifgtlsgrkvvvmqgrfhmyegysndtvalpirvmkllgvkilmvsnaagglnrs
    lklgdfvilkdhiylpglglnnilvgpnqeafgtrfpalsnaydrdlrklavqvaeengf
    gnlvhqgvyvmnggpcyetpaectmllnmgcdvvgmstipevviarhcgiqvfavslvtn
    isvldvesdlkpnheevlatgaqraelmqswfekiieklpkd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1td1B (B:)
    mhesvtanienvkkvahhiqkltsivpeigiicgsglgkladgvkdkitipytkipnfpq
    tsvvghsgnlifgtlsgrkvvvmqgrfhmyegysndtvalpirvmkllgvkilmvsnaag
    glnrslklgdfvilkdhiylpglglnnilvgpnqeafgtrfpalsnaydrdlrklavqva
    eengfgnlvhqgvyvmnggpcyetpaectmllnmgcdvvgmstipevviarhcgiqvfav
    slvtnisvldvesdlkpnheevlatgaqraelmqswfekiieklpkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1td1B (B:)
    esvtanienvkkvahhiqkltsivpeigiicgsglgkladgvkdkitipytkipnfpqts
    vvghsgnlifgtlsgrkvvvmqgrfhmyegysndtvalpirvmkllgvkilmvsnaaggl
    nrslklgdfvilkdhiylpglglnnilvgpnqeafgtrfpalsnaydrdlrklavqvaee
    ngfgnlvhqgvyvmnggpcyetpaectmllnmgcdvvgmstipevviarhcgiqvfavsl
    vtnisvldvesaqraelmqswfekiieklpkd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1td1C (C:)
    mhesvtanienvkkvahhiqkltsivpeigiicgsglgkladgvkdkitipytkipnfpq
    tsvvghsgnlifgtlsgrkvvvmqgrfhmyegysndtvalpirvmkllgvkilmvsnaag
    glnrslklgdfvilkdhiylpglglnnilvgpnqeafgtrfpalsnaydrdlrklavqva
    eengfgnlvhqgvyvmnggpcyetpaectmllnmgcdvvgmstipevviarhcgiqvfav
    slvtnisvldvesdlkpnheevlatgaqraelmqswfekiieklpkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1td1C (C:)
    esvtanienvkkvahhiqkltsivpeigiicgsglgkladgvkdkitipytkipnfpqts
    vvghsgnlifgtlsgrkvvvmqgrfhmyegysndtvalpirvmkllgvkilmvsnaaggl
    nrslklgdfvilkdhiylpglglnnilvgpnqeafgtrfpalsnaydrdlrklavqvaee
    ngfgnlvhqgvyvmnggpcyetpaectmllnmgcdvvgmstipevviarhcgiqvfavsl
    vtnisvldvesdlkpnheevlatgaqraelmqswfekiieklpkd