PDB entry 1tcp

View 1tcp on RCSB PDB site
Description: nmr structure determination of tick anticoagulant peptide (tap)
Class: blood coagulation inhibitor
Keywords: factor xa serine protease inhibitor, blood coagulation inhibitor
Deposited on 1994-10-31, released 1995-10-31
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tick anticoagulant peptide
    Species: Ornithodoros moubata [TaxId:6938]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1tcpa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tcpA (A:)
    ynrlcikprdwidecdsneggerayfrngkggcdsfwicpedhtgadyyssyrdcfnaci