PDB entry 1tce

View 1tce on RCSB PDB site
Description: solution nmr structure of the shc sh2 domain complexed with a tyrosine-phosphorylated peptide from the T-cell receptor, minimized average structure
Class: complex (signal transduction/peptide)
Keywords: sh2 domain, complex (signal transduction/peptide)
Deposited on 1996-03-27, released 1997-05-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: shc
    Species: Homo sapiens [TaxId:9606]
    Gene: SH2 DOMAIN OF SHC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29353 (0-103)
      • conflict (45)
    Domains in SCOPe 2.07: d1tcea1, d1tcea2
  • Chain 'B':
    Compound: phosphopeptide of the zeta chain of t cell receptor
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20963 (0-13)
      • modified residue (5)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tceA (A:)
    aeqlrgepwfhgklsrreaeallqlngdflvrestttpgqyvltgsqsgqpkhlllvdpe
    gvvrtkdhrfesvshlisyhmdnhlpiisagselclqqpverklleh
    

  • Chain 'B':
    No sequence available.