PDB entry 1tce

View 1tce on RCSB PDB site
Description: solution nmr structure of the shc sh2 domain complexed with a tyrosine-phosphorylated peptide from the T-cell receptor, minimized average structure
Class: complex (signal transduction/peptide)
Keywords: sh2 domain, complex (signal transduction/peptide)
Deposited on 1996-03-27, released 1997-05-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: shc
  Species: Homo sapiens [TaxId:9606]
  Gene: SH2 DOMAIN OF SHC
  Database cross-references and differences (RAF-indexed):
  • Uniprot P29353 (0-103)
    • conflict (45)
  Domains in SCOPe 2.06: d1tcea1, d1tcea2
• Chain 'B':
  Compound: phosphopeptide of the zeta chain of t cell receptor
  Database cross-references and differences (RAF-indexed):
  • Uniprot P20963 (0-13)
    • modified residue (5)

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1tceA (A:)
  aeqlrgepwfhgklsrreaeallqlngdflvrestttpgqyvltgsqsgqpkhlllvdpe
  gvvrtkdhrfesvshlisyhmdnhlpiisagselclqqpverklleh
  

  
  
• Chain 'B':
  No sequence available.