PDB entry 1tce

View 1tce on RCSB PDB site
Description: solution nmr structure of the shc sh2 domain complexed with a tyrosine-phosphorylated peptide from the t-cell receptor, minimized average structure
Deposited on 1996-03-27, released 1997-05-15
The last revision prior to the SCOP 1.59 freeze date was dated 1997-05-15, with a file datestamp of 1997-05-16.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.59: d1tcea_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1tceA (A:)
  aeqlrgepwfhgklsrreaeallqlngdflvrestttpgqyvltgsqsgqpkhlllvdpe
  gvvrtkdhrfesvshlisyhmdnhlpiisagselclqqpverklleh