PDB entry 1tb6

View 1tb6 on RCSB PDB site
Description: 2.5A Crystal Structure of the Antithrombin-Thrombin-Heparin Ternary Complex
Class: hydrolase/blood clotting
Keywords: Heparin
Deposited on 2004-05-19, released 2004-08-17
The last revision prior to the SCOP 1.75 freeze date was dated 2004-09-21, with a file datestamp of 2007-07-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.208
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: thrombin
    Species: HOMO SAPIENS
    Gene: F2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00734 (0-258)
      • engineered (204)
    Domains in SCOP 1.75: d1tb6.1
  • Chain 'I':
    Compound: antithrombin-III
    Species: HOMO SAPIENS
    Gene: SERPINC1, AT3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01008
      • engineered (136)
      • engineered (316)
      • engineered (400)
    Domains in SCOP 1.75: d1tb6i_
  • Chain 'L':
    Compound: thrombin
    Species: HOMO SAPIENS
    Gene: F2
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1tb6.1
  • Heterogens: NDG, MPD, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tb6H (H:)
    ivegsdaeigmspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftendll
    vrigkhsrtryerniekismlekiyihprynwrenldrdialmklkkpvafsdyihpvcl
    pdretaasllqagykgrvtgwgnlketwtanvgkgqpsvlqvvnlpiverpvckdstrir
    itdnmfcagykpdegkrgdacegdaggpfvmkspfnnrwyqmgivswgegcdrdgkygfy
    thvfrlkkwiqkvidqfge
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1tb6I (I:)
    hgspvdictakprdipmnpmciyrspekkatedegseqkipeatnrrvwelskansrfat
    tfyqhladskndndniflsplsistafamtklgacndtlqqlmevfkfdtisektsdqih
    fffaklncrlyrkankasklvsanrlfgdksltfnetyqdiselvygaklqpldfkenae
    qsraainkwvsnktegritdvipseaineltvlvlvntiyfkglwkskfspentrkelfy
    kadgescsasmmyqegkfryrrvaegtqvlelpfkgdditmvlilpkpekslakvekelt
    pevlqewldeleemmlcvhmprfriedgfslkeqlqdmglvdlfspeksklpgivaegrd
    dlyvsdafhkaflevneegseaaastavviagrslnpnrvcfkanrpflvfirevplnti
    ifmgrvanpcvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tb6I (I:)
    pvdictakprdipmnpmciyrspeqkipeatnrrvwelskansrfattfyqhladskndn
    dniflsplsistafamtklgacndtlqqlmevfkfdtisektsdqihfffaklncrlyrk
    ankasklvsanrlfgdksltfnetyqdiselvygaklqpldfkenaeqsraainkwvsnk
    tegritdvipseaineltvlvlvntiyfkglwkskfspentrkelfykadgescsasmmy
    qegkfryrrvaegtqvlelpfkgdditmvlilpkpekslakvekeltpevlqewldelee
    mmlcvhmprfriedgfslkeqlqdmglvdlfspeksklpgivaegrddlyvsdafhkafl
    evneegtavviagrslnpnrvcfkanrpflvfirevplntiifmgrvanpcv
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1tb6L (L:)
    tatseyqtffnprtfgsgeadcglrplfekksledkterellesyidgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tb6L (L:)
    seyqtffnprtfgsgeadcglrplfekksledkterellesyi