PDB entry 1tb5

View 1tb5 on RCSB PDB site
Description: Catalytic Domain Of Human Phosphodiesterase 4B In Complex With AMP
Class: hydrolase
Keywords: PDE4B, hydrolase
Deposited on 2004-05-19, released 2004-08-03
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.235
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4B
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1tb5a_
  • Chain 'B':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4B
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1tb5b_
  • Heterogens: ZN, MG, AMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tb5A (A:)
    gshmsisrfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllk
    tfrissdtfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaa
    ifaaaihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnlt
    kkqrqtlrkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnm
    vhcadlsnptkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfi
    dyivhplwetwadlvqpdaqdildtlednrnwyqsmipqspsppldeqnrdcqglmekfq
    feltldeedsegpekegeghs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tb5A (A:)
    edhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfrissdtfitymmt
    ledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaaaihdvdhpgvs
    nqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqrqtlrkmvidmv
    latdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhcadlsnptkslel
    yrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyivhplwetwadlv
    qpdaqdildtlednrnwyqsmip
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tb5B (B:)
    gshmsisrfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllk
    tfrissdtfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaa
    ifaaaihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnlt
    kkqrqtlrkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnm
    vhcadlsnptkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfi
    dyivhplwetwadlvqpdaqdildtlednrnwyqsmipqspsppldeqnrdcqglmekfq
    feltldeedsegpekegeghs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tb5B (B:)
    edhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfrissdtfitymmt
    ledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaaaihdvdhpgvs
    nqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqrqtlrkmvidmv
    latdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhcadlsnptkslel
    yrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyivhplwetwadlv
    qpdaqdildtlednrnwyqsmip