PDB entry 1tap

View 1tap on RCSB PDB site
Description: nmr solution structure of recombinant tick anticoagulant protein (rtap), a factor xa inhibitor from the tick ornithodoros moubata
Class: proteinase inhibitor
Keywords: proteinase inhibitor
Deposited on 1994-08-16, released 1994-11-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: factor xa inhibitor
    Species: Ornithodoros moubata [TaxId:6938]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1tapa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tapA (A:)
    ynrlcikprdwidecdsneggerayfrngkggcdsfwicpedhtgadyyssyrdcfnaci