PDB entry 1tap

View 1tap on RCSB PDB site
Description: nmr solution structure of recombinant tick anticoagulant protein (rtap), a factor xa inhibitor from the tick ornithodoros moubata
Deposited on 1994-08-16, released 1994-11-30
The last revision prior to the SCOP 1.61 freeze date was dated 1994-11-30, with a file datestamp of 1994-12-07.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.61: d1tap__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tap_ (-)
    ynrlcikprdwidecdsneggerayfrngkggcdsfwicpedhtgadyyssyrdcfnaci