PDB entry 1t9r

View 1t9r on RCSB PDB site
Description: Catalytic Domain Of Human Phosphodiesterase 5A
Class: hydrolase
Keywords: hydrolase, PDE5A
Deposited on 2004-05-18, released 2004-08-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.204
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cGMP-specific 3',5'-cyclic phosphodiesterase
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE5A, PDE5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1t9ra_
  • Heterogens: ZN, PO4, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t9rA (A:)
    mgsshhhhhhssglvprgshmsaaeeetrelqslaaavvpsaqtlkitdfsfsdfelsdl
    etalctirmftdlnlvqnfqmkhevlcrwilsvkknyrknvayhnwrhafntaqcmfaal
    kagkiqnkltdleilalliaalshdldhrgvnnsyiqrsehplaqlychsimehhhfdqc
    lmilnspgnqilsglsieeykttlkiikqailatdlalyikrrgeffelirknqfnledp
    hqkelflamlmtacdlsaitkpwpiqqriaelvateffdqgdrerkelnieptdlmnrek
    knkipsmqvgfidaiclqlyealthvsedcfplldgcrknrqkwqalaeqqekmlinges
    gqakrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t9rA (A:)
    eeetrelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhe
    vlcrwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalsh
    dldhlaqlychsimehhhfdqclmilnspgnqilsglsieeykttlkiikqailatdlal
    yikrrgeffelirknqfnledphqkelflamlmtacdlsaitkpwpiqqriaelvateff
    dqlmnrekknkipsmqvgfidaiclqlyealthvsedcfplldgcrknrqkwqalaeqqe
    k