PDB entry 1t9q

View 1t9q on RCSB PDB site
Description: Crystal Structure of V44L Cp Rubredoxin
Class: electron transport
Keywords: rubredoxin, ELECTRON TRANSPORT
Deposited on 2004-05-18, released 2004-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.206
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubredoxin
    Species: Clostridium pasteurianum [TaxId:1501]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00268 (0-End)
      • engineered (43)
    Domains in SCOPe 2.07: d1t9qa_
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t9qA (A:)
    mkkytctvcgyiynpedgdpdngvnpgtdfkdipddwvcplcglgkdqfeevee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t9qA (A:)
    mkkytctvcgyiynpedgdpdngvnpgtdfkdipddwvcplcglgkdqfeeve