PDB entry 1t9o

View 1t9o on RCSB PDB site
Description: Crystal Structure of V44G Cp Rubredoxin
Class: electron transport
Keywords: rubredoxin, ELECTRON TRANSPORT
Deposited on 2004-05-18, released 2004-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.173
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubredoxin
    Species: Clostridium pasteurianum [TaxId:1501]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00268
      • engineered (43)
    Domains in SCOPe 2.07: d1t9oa_
  • Chain 'B':
    Compound: rubredoxin
    Species: Clostridium pasteurianum [TaxId:1501]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00268
      • engineered (43)
    Domains in SCOPe 2.07: d1t9ob_
  • Chain 'C':
    Compound: rubredoxin
    Species: Clostridium pasteurianum [TaxId:1501]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00268 (0-End)
      • engineered (43)
    Domains in SCOPe 2.07: d1t9oc_
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t9oA (A:)
    mkkytctvcgyiynpedgdpdngvnpgtdfkdipddwvcplcgggkdqfeevee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t9oA (A:)
    mkkytctvcgyiynpedgdpdngvnpgtdfkdipddwvcplcgggkdqfeeve
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t9oB (B:)
    mkkytctvcgyiynpedgdpdngvnpgtdfkdipddwvcplcgggkdqfeevee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t9oB (B:)
    mkkytctvcgyiynpedgdpdngvnpgtdfkdipddwvcplcgggkdqfeeve
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1t9oC (C:)
    mkkytctvcgyiynpedgdpdngvnpgtdfkdipddwvcplcgggkdqfeevee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t9oC (C:)
    mkkytctvcgyiynpedgdpdngvnpgtdfkdipddwvcplcgggkdqfeeve